PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_11853_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 831aa    MW: 92327.4 Da    PI: 8.878
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_11853_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding223.7e-07204247246
                                           SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
                       Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                           ++W+t Ed++l+++ ++  ++ W  Ia  +g++Rt+ qc  r+q 
  cra_locus_11853_iso_1_len_2592_ver_3 204 NPWSTMEDKKLLHVLEKGLSN-WIDIAVSLGTNRTPFQCLARYQR 247
                                           58***********99987766.*********************96 PP

2Myb_DNA-binding50.16.2e-16255301148
                                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                           r  WT+eEd +l  av+ +G ++W ++a+ m  gRt+ qc +rw k l
  cra_locus_11853_iso_1_len_2592_ver_3 255 RREWTEEEDNQLRAAVEAFGERNWQAVASAME-GRTGAQCSNRWKKTL 301
                                           678*****************************.***********9975 PP

3Myb_DNA-binding56.37.2e-18309352246
                                           SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
                       Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                           grWT++Ed++l+ av ++G++tW++Ia+ ++ gRt  qc++rw +
  cra_locus_11853_iso_1_len_2592_ver_3 309 GRWTPDEDKRLKVAVMLFGPKTWNKIAQFVP-GRTQVQCRERWVN 352
                                           8******************************.***********87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.063102199IPR001005SANT/Myb domain
PROSITE profilePS500905.97103195IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.602.8E-10105121IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.8E-10169210IPR009057Homeodomain-like
SuperFamilySSF466892.47E-13179245IPR009057Homeodomain-like
PROSITE profilePS500907.991198249IPR017877Myb-like domain
SMARTSM007172.0E-4202251IPR001005SANT/Myb domain
PfamPF002491.4E-5204247IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.2E-11211262IPR009057Homeodomain-like
SuperFamilySSF466891.65E-20234306IPR009057Homeodomain-like
PROSITE profilePS5129423.204250305IPR017930Myb domain
SMARTSM007171.2E-15254303IPR001005SANT/Myb domain
PfamPF002494.8E-14255300IPR001005SANT/Myb domain
CDDcd001675.25E-13257301No hitNo description
Gene3DG3DSA:1.10.10.606.6E-18263307IPR009057Homeodomain-like
PROSITE profilePS5129419.393306358IPR017930Myb domain
SMARTSM007174.0E-15307356IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-21309371IPR009057Homeodomain-like
PfamPF002492.3E-16309352IPR001005SANT/Myb domain
SuperFamilySSF466892.12E-19309368IPR009057Homeodomain-like
CDDcd001671.07E-12310354No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 831 aa     Download sequence    Send to blast
XSFQKLLRAK LMHIEARVEE IRKLKDRVKI LKDFQAGCRK RTGRALSQKK DARVQLISLP  60
KIRANAKLNS EKKSSAMYYG PAENCQVANY QEALKQFLVF LDREKWTKEE KGNLSKGVKQ  120
QFQEMILTRS LDLVSGADGS LGDSSNLDSI FASIRDHDIT PENMRLFIPM VNWDQLASMY  180
VPGRSGAACQ SRWLNCDDPL INQNPWSTME DKKLLHVLEK GLSNWIDIAV SLGTNRTPFQ  240
CLARYQRSLN ASILRREWTE EEDNQLRAAV EAFGERNWQA VASAMEGRTG AQCSNRWKKT  300
LNPARKKVGR WTPDEDKRLK VAVMLFGPKT WNKIAQFVPG RTQVQCRERW VNSLDPSVNW  360
NEWTEEEDLK LQAAISEMDI VGPVLPHVFL DGLTINAGGD GRFXLQMMSN FVDRESERPA  420
LGPNDFIPLP AISAGPEHVN ANHPRRQKRR SRRREETTVT ETPDTLAVAP ISNGEGLETS  480
GGLNLSEEGN NAMEKREDPE ATASKEKARK LNSKNDESCE TECPLSCLTD PSLSLITIGE  540
GVGELGRDDG GASQLRKASK LQPRRRSKHM EGNGRSEHLE ENGVSSSTYG EDVNELSRDG  600
EDDTRPKKAS KPPDDVPGIS ISNHVKTSIG KKSKAGSTSK GSYGAADVMD QFSSLSNAKS  660
LMTRGKEARK RKRESPTFPG SENACKVSSA SEGNLELQNG NAGVEEQIQN SSSPVWCLTP  720
DSLEIENSKA LEFRGHDKHK TPKDVVEEED NDLTIATFLK QSHGAKTTLP SSSSVKVDKL  780
DKKGIVNAEA SAATLSSSNK LHSAEAGDEM TLAVFCNKLK KRKTNNKQKR T
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C6e-261723749159MYB PROTO-ONCOGENE PROTEIN
1h89_C6e-261723749159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1444452RRQKRRSRR
2446452QKRRSRR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A068TQ560.0A0A068TQ56_COFCA; Uncharacterized protein
STRINGSolyc03g119050.2.11e-176(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA108762124